Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBQLN4 Peptide - C-terminal region

UBQLN4 Peptide - C-terminal region

Product Specifications

UniProt

D3DVA8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBQLN4 Rabbit Polyclonal Antibody (orb583536) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPSLGSFGMSRTPAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RITA Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-11945R-BF647 100 µL

RITA Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
CAMK2D (NM_172128) Human Untagged Clone
SC126554 10 µg

CAMK2D (NM_172128) Human Untagged Clone

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody
abx270059-01 50 Tests

Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody
abx270059-02 100 Tests

Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody
abx270059-03 200 Tests

Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody

Sign In for Pricing
View Details
Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody
abx270059-04 500 Tests

Programmed Cell Death Protein 1 Ligand 2 (PDCD1LG2) Antibody

Sign In for Pricing
View Details