Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED25 Peptide - C-terminal region

MED25 Peptide - C-terminal region

Product Specifications

UniProt

B9TX37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED25 Rabbit Polyclonal Antibody (orb581182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1E1 (NM_001039366) Human Tagged Lenti ORF Clone
RC217650L3 10 µg

ATP6V1E1 (NM_001039366) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CCL5 Recombinant Protein
91-049 0.05 mg

CCL5 Recombinant Protein

Sign In for Pricing
View Details
Erythrosin B
sc-214971 5 g

Erythrosin B

Sign In for Pricing
View Details
Anserini AGTR2 ELISA Kit
EAA0503 96 Tests

Anserini AGTR2 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Zfp787 shRNA (UAS) - Lentiviral mouse Zfp787 shRNA (UAS) plasmid
GTR15179263 1 Vial

Lentiviral mouse Zfp787 shRNA (UAS) - Lentiviral mouse Zfp787 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Plastic Box, Big
1021380/1 1 Each

Plastic Box, Big

Sign In for Pricing
View Details