Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED25 Peptide - C-terminal region

MED25 Peptide - C-terminal region

Product Specifications

UniProt

B9TX37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED25 Rabbit Polyclonal Antibody (orb581182) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory receptor 4C15 Polyclonal Antibody
JOT-AP06441-01 20 µL

Olfactory receptor 4C15 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 4C15 Polyclonal Antibody
JOT-AP06441-02 50 μL

Olfactory receptor 4C15 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 4C15 Polyclonal Antibody
JOT-AP06441-03 100 µL

Olfactory receptor 4C15 Polyclonal Antibody

Sign In for Pricing
View Details
ACP5 Antibody
MBS2520818-01 0.06 mL

ACP5 Antibody

Sign In for Pricing
View Details
ACP5 Antibody
MBS2520818-02 0.12 mL

ACP5 Antibody

Sign In for Pricing
View Details
ACP5 Antibody
MBS2520818-03 0.2 mL

ACP5 Antibody

Sign In for Pricing
View Details