Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS44 Peptide - middle region

PRSS44 Peptide - middle region

Product Specifications

UniProt

E7EML9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVLKEKIRMRSEMVKKGTICGYNDQGKDACQGDSGGPLVCELNGTWVQVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRQ Polyclonal Antibody
MBS9431833-01 0.05 mL

GABRQ Polyclonal Antibody

Sign In for Pricing
View Details
GABRQ Polyclonal Antibody
MBS9431833-02 0.1 mL

GABRQ Polyclonal Antibody

Sign In for Pricing
View Details
GABRQ Polyclonal Antibody
MBS9431833-03 5x 0.1 mL

GABRQ Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human DNMT3A Protein, N-His
HV233012-01 50 µg

Recombinant Human DNMT3A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DNMT3A Protein, N-His
HV233012-02 100 µg

Recombinant Human DNMT3A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DNMT3A Protein, N-His
HV233012-03 1 mg

Recombinant Human DNMT3A Protein, N-His

Sign In for Pricing
View Details