Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS44 Peptide - middle region

PRSS44 Peptide - middle region

Product Specifications

UniProt

E7EML9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVLKEKIRMRSEMVKKGTICGYNDQGKDACQGDSGGPLVCELNGTWVQVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP3 Protein Vector (Rat) (pPB-N-His)
PV266979 500 ng

FABP3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Sulfite Oxidase (SUOX) ELISA Kit
MBS2023602-01 24 Strip Well

Mouse Sulfite Oxidase (SUOX) ELISA Kit

Sign In for Pricing
View Details
Mouse Sulfite Oxidase (SUOX) ELISA Kit
MBS2023602-02 48 Well

Mouse Sulfite Oxidase (SUOX) ELISA Kit

Sign In for Pricing
View Details
Mouse Sulfite Oxidase (SUOX) ELISA Kit
MBS2023602-03 96 Well

Mouse Sulfite Oxidase (SUOX) ELISA Kit

Sign In for Pricing
View Details
Mouse Sulfite Oxidase (SUOX) ELISA Kit
MBS2023602-04 5x 96 Well

Mouse Sulfite Oxidase (SUOX) ELISA Kit

Sign In for Pricing
View Details
Mouse Sulfite Oxidase (SUOX) ELISA Kit
MBS2023602-05 10x 96 Well

Mouse Sulfite Oxidase (SUOX) ELISA Kit

Sign In for Pricing
View Details