BMP8B Peptide - middle region
BMP8B Peptide - middle region
Product Specifications
Product Name Alternative
OP2, BMP8
UniProt
P34820
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BMP8B Rabbit Polyclonal Antibody (orb586064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001711.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LS009133 100 µg
Cyclin B2 (CCNB2) (NM_004701) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS7230490-01 48 Well
Goat Basic leucine zipper and W2 domain-containing protein 2 (BZW2) ELISA Kit
Sign In for Pricing
View Details MBS7230490-02 96 Well
Goat Basic leucine zipper and W2 domain-containing protein 2 (BZW2) ELISA Kit
Sign In for Pricing
View Details MBS7230490-03 5x 96 Well
Goat Basic leucine zipper and W2 domain-containing protein 2 (BZW2) ELISA Kit
Sign In for Pricing
View Details