Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP8B Peptide - middle region

BMP8B Peptide - middle region

Product Specifications

Product Name Alternative

OP2, BMP8

UniProt

P34820

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BMP8B Rabbit Polyclonal Antibody (orb586064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001711.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRPLRRRQPKKTNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1604 Rabbit Polyclonal Antibody (HRP)
orb2124614 100 µL

KIAA1604 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
4-[ (2-phenoxyethyl) amino]butanoic acid hydrochloride
sc-348527 250 mg

4-[ (2-phenoxyethyl) amino]butanoic acid hydrochloride

Sign In for Pricing
View Details
SLC39A4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2189708 1.0 µg DNA

SLC39A4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-MFAP3 Mouse Monoclonal Antibody [Clone ID: OTI1B3]
M13942 100 µL

Anti-MFAP3 Mouse Monoclonal Antibody [Clone ID: OTI1B3]

Sign In for Pricing
View Details
t-Boc-Aminooxy-PEG3-amine
571944 100.0mg

t-Boc-Aminooxy-PEG3-amine

Sign In for Pricing
View Details
TBLR1 Rabbit Polyclonal Antibody (Cy7)
orb1043793 100 µL

TBLR1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details