SHBG Peptide - N-terminal region
SHBG Peptide - N-terminal region
Product Specifications
UniProt
I3L1J1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SHBG Rabbit Polyclonal Antibody (orb585496) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880896-100 1x 100 µL
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LY401672 100 µg
Noggin (NOG) (NM_005450) Human Over-expression Lysate
Sign In for Pricing
View Details 