Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA6 Peptide - N-terminal region

PSMA6 Peptide - N-terminal region

Product Specifications

UniProt

G3V295

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMA6 Rabbit Polyclonal Antibody (orb577577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100P (NM_005980) Human Recombinant Protein
TP720231L 500 µg

S100P (NM_005980) Human Recombinant Protein

Sign In for Pricing
View Details
JUNB pSer259 Rabbit Polyclonal Antibody
AP02328PU-N 100 µL

JUNB pSer259 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Prostate
CP565641 150 µg

Tissue Protein Lysate, Prostate

Sign In for Pricing
View Details
KTI12 (NM_138417) Human Recombinant Protein
TP304261L 1 mg

KTI12 (NM_138417) Human Recombinant Protein

Sign In for Pricing
View Details
F261/4 Antibody
8C11146-AAT 50 µg

F261/4 Antibody

Sign In for Pricing
View Details
Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody [Clone ID: OTI3B5]
CF808908 100 µg

Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody [Clone ID: OTI3B5]

Sign In for Pricing
View Details