Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA6 Peptide - N-terminal region

PSMA6 Peptide - N-terminal region

Product Specifications

UniProt

G3V295

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PSMA6 Rabbit Polyclonal Antibody (orb577577) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAPP1 Mouse Monoclonal Antibody [Clone ID: OTI1C10]
CF810197 100 µg

DAPP1 Mouse Monoclonal Antibody [Clone ID: OTI1C10]

Sign In for Pricing
View Details
FAU Rabbit Polyclonal Antibody
AP11620PU-N 400 µL

FAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human DAP5 (EIF4G2) activation kit by CRISPRa
GA101373 1 Kit

Human DAP5 (EIF4G2) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS628773 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
RPS28 Human Gene Knockout Kit (CRISPR)
KN422795 1 Kit

RPS28 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
hnRNP R (HNRNPR) (NM_001102397) Human Over-expression Lysate
LY420140 100 µg

hnRNP R (HNRNPR) (NM_001102397) Human Over-expression Lysate

Sign In for Pricing
View Details