Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6M1 Peptide - C-terminal region

OR6M1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-271

UniProt

Q8NGM8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6M1 Rabbit Polyclonal Antibody (orb587629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005325

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SNIFVYVRPNQNSSLDYDKVAAVLITVVTPLLNPFIYSLRNEKVQEVLRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mephenoxalone
TRC-M224900-25MG 25 mg

Mephenoxalone

Sign In for Pricing
View Details
ExoQuick® UltraPure EV Isolation Kit
EQ UltraPure 10 Reactions

ExoQuick® UltraPure EV Isolation Kit

Sign In for Pricing
View Details
Human ZNF585A activation kit by CRISPRa
GA116311 1 Kit

Human ZNF585A activation kit by CRISPRa

Sign In for Pricing
View Details
Texas Red Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-II-
T-2202-2 2 mg

Texas Red Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-II-

Sign In for Pricing
View Details
GCSF Receptor (CSF3R) Rabbit Monoclonal Antibody
TA423205 100 µL

GCSF Receptor (CSF3R) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human Siglec-3 / CD33 Protein, Llama IgG2b Fc Tag, low endotoxin
CD3-H5259-1mg 1 mg

Human Siglec-3 / CD33 Protein, Llama IgG2b Fc Tag, low endotoxin

Sign In for Pricing
View Details