OR6M1 Peptide - C-terminal region
OR6M1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR11-271
UniProt
Q8NGM8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR6M1 Rabbit Polyclonal Antibody (orb587629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005325
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SNIFVYVRPNQNSSLDYDKVAAVLITVVTPLLNPFIYSLRNEKVQEVLRE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940955-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Elab Fluor® Violet 500 Armenian Hamster IgG Isotype Control[PIP]](https://cdn.genprice.uk/products/763/68dd14b0061270361e7d3b21/imageurl/e-ab-f09852r.webp)
E-AB-F09852R-01 20 Tests
Elab Fluor® Violet 500 Armenian Hamster IgG Isotype Control[PIP]
Sign In for Pricing
View Details E-AB-F09852R-02 100 Tests
Elab Fluor® Violet 500 Armenian Hamster IgG Isotype Control[PIP]
Sign In for Pricing
View Details E-AB-F09852R-03 2x 100 Tests
Elab Fluor® Violet 500 Armenian Hamster IgG Isotype Control[PIP]
Sign In for Pricing
View Details