Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPM1 Peptide - C-terminal region

TRPM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MLSN1, CSNB1C, LTRPC1

UniProt

Q7Z4N2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001238949.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 6 (LHK6), 0.2mg/mL
BNUB0675-100 1x 100 µL

Cytokeratin 6 (LHK6), 0.2mg/mL

Sign In for Pricing
View Details
ITS3-ITS4 Library Preparation Kit for Illumina
71100 24 Preparations

ITS3-ITS4 Library Preparation Kit for Illumina

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS507915 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), Biotin conjugate, 0.1mg/mL
BNCB2113-500 1x 500 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-(Diphenylphosphino)benzenesulfonic Acid Sodium Salt
TRC-D494920-50MG 50 mg

3-(Diphenylphosphino)benzenesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
EIF2AK1 Human Gene Knockout Kit (CRISPR)
KN200065 1 Kit

EIF2AK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details