Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRPM1 Peptide - C-terminal region

TRPM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MLSN1, CSNB1C, LTRPC1

UniProt

Q7Z4N2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001238949.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK1 Rabbit Polyclonal Antibody
ER2001-72 100 µL

GRK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene AM RAM
H40023.5G 5 g

Polystyrene AM RAM

Sign In for Pricing
View Details
Cytokeratin 18 (DC10), CF647 conjugate, 0.1mg/mL
BNC470021-100 1x 100 µL

Cytokeratin 18 (DC10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS504937 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
HSP70-1A (HSPA1A) (NM_005345) Human Over-expression Lysate
LY401646 100 µg

HSP70-1A (HSPA1A) (NM_005345) Human Over-expression Lysate

Sign In for Pricing
View Details
RAB39B Rabbit Polyclonal Antibody
TA369631 100 µL

RAB39B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details