Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTTP Peptide - C-terminal region

MTTP Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABL, MTP

UniProt

P55157

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTTP Rabbit Polyclonal Antibody (orb578891) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000244

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR193B ORF Vector (Human) (pORF)
ORF023800 1.0 µg DNA

MIR193B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SPRING1 Human shRNA Lentiviral Particle (Locus ID 79794)
TL306235V 500 µL Each

SPRING1 Human shRNA Lentiviral Particle (Locus ID 79794)

Sign In for Pricing
View Details
Pkd2-set siRNA/shRNA/RNAi Lentivector (Mouse)
36871094 4x 500 ng

Pkd2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
N- (2,6-dichloro-4-pyridyl) -N'-piperidinourea
OR27056 1 Each

N- (2,6-dichloro-4-pyridyl) -N'-piperidinourea

Sign In for Pricing
View Details
ALPPL2 Antibody
CSB-PA182593-01 50 μL

ALPPL2 Antibody

Sign In for Pricing
View Details
ALPPL2 Antibody
CSB-PA182593-02 100 µL

ALPPL2 Antibody

Sign In for Pricing
View Details