Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTTP Peptide - C-terminal region

MTTP Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABL, MTP

UniProt

P55157

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTTP Rabbit Polyclonal Antibody (orb578891) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000244

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QVVIEAQGLEALIAATPDEGEENLDSYAGMSAILFDVQLRPVTFFNGYSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana ETHYLENE INSENSITIVE 3-like 5 protein (EIL5) , partial
MBS1403612 Inquire

Recombinant Arabidopsis thaliana ETHYLENE INSENSITIVE 3-like 5 protein (EIL5) , partial

Sign In for Pricing
View Details
SPRY1 Antibody, Biotin conjugated
MBS1496299-01 0.05 mg

SPRY1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SPRY1 Antibody, Biotin conjugated
MBS1496299-02 0.1 mg

SPRY1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SPRY1 Antibody, Biotin conjugated
MBS1496299-03 5x 0.1 mg

SPRY1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human Aryl Hydrocarbon Receptor (AhR) ELISA Kit
DLR-AhR-Hu-96T 96 Tests

Human Aryl Hydrocarbon Receptor (AhR) ELISA Kit

Sign In for Pricing
View Details
Staphylococcus aureus Enterotoxin B (SEB) (APC)
S7965-35A-APC 100 µL

Staphylococcus aureus Enterotoxin B (SEB) (APC)

Sign In for Pricing
View Details