Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP2 Peptide - C-terminal region

PARP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADPRT2, ADPRTL2, ADPRTL3, ARTD2, PARP-2, pADPRT-2

UniProt

Q9UGN5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARP2 Rabbit Polyclonal Antibody (orb329743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036083

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdfy1 Mouse Gene Knockout Kit (CRISPR)
KN519330 1 Kit

Wdfy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF740 conjugate, 0.1mg/mL
BNC742970-500 1x 500 µL

MUC2 (Mucin 2) (MLP/2970R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Brain Natriuretic Peptide/BNP Protein (His & Flag Tag)
PKSH032127-01 10 µg

Recombinant Human Brain Natriuretic Peptide/BNP Protein (His & Flag Tag)

Sign In for Pricing
View Details
Recombinant Human Brain Natriuretic Peptide/BNP Protein (His & Flag Tag)
PKSH032127-02 50 µg

Recombinant Human Brain Natriuretic Peptide/BNP Protein (His & Flag Tag)

Sign In for Pricing
View Details
ADAM12 Rabbit Polyclonal Antibody
TA371198 100 µL

ADAM12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HpaII, 500U
RE1282 500 U

HpaII, 500U

Sign In for Pricing
View Details