Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARP2 Peptide - C-terminal region

PARP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADPRT2, ADPRTL2, ADPRTL3, ARTD2, PARP-2, pADPRT-2

UniProt

Q9UGN5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARP2 Rabbit Polyclonal Antibody (orb329743) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036083

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanosine-13C5 5'-Monophosphate
TRC-G838514-5MG 5 mg

Guanosine-13C5 5'-Monophosphate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS703851 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF405S conjugate, 0.1mg/mL
BNC042488-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Canine Coagulation Factor VIII (F8) ELISA Kit
RD-F8-c-01 96 Tests

Canine Coagulation Factor VIII (F8) ELISA Kit

Sign In for Pricing
View Details
Canine Coagulation Factor VIII (F8) ELISA Kit
RD-F8-c-02 48 Tests

Canine Coagulation Factor VIII (F8) ELISA Kit

Sign In for Pricing
View Details
Creatine kinase B type (CKB) Rabbit Polyclonal Antibody
AP13618PU-N 400 µL

Creatine kinase B type (CKB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details