Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXW5 Peptide - N-terminal region

FBXW5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FBXW5, FBW5, PP3971

UniProt

Q969U6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXW5 Rabbit Polyclonal Antibody (orb587997) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NDLTISLLHSADMRPYNWSYTQFSQFNKDDSLLLASGVFLGPHNSSSGEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryptochrome 1 Rabbit Polyclonal Antibody (BF594)
orb2461929 100 µL

Cryptochrome 1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Sirtuin2 Rabbit Polyclonal Antibody
orb155292 100 µg

Sirtuin2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4,4'-Bis (ethoxycarbonyl) -2,2'-bipyridine
261800-01 1 g

4,4'-Bis (ethoxycarbonyl) -2,2'-bipyridine

Sign In for Pricing
View Details
4,4'-Bis (ethoxycarbonyl) -2,2'-bipyridine
261800-02 2 g

4,4'-Bis (ethoxycarbonyl) -2,2'-bipyridine

Sign In for Pricing
View Details
4,4'-Bis (ethoxycarbonyl) -2,2'-bipyridine
261800-03 5 g

4,4'-Bis (ethoxycarbonyl) -2,2'-bipyridine

Sign In for Pricing
View Details
4,4'-Bis (ethoxycarbonyl) -2,2'-bipyridine
261800-04 10 g

4,4'-Bis (ethoxycarbonyl) -2,2'-bipyridine

Sign In for Pricing
View Details