Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKAL1 Peptide - N-terminal region

CDKAL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDKAL1

UniProt

Q5VV42

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKAL1 Rabbit Polyclonal Antibody (orb331431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Bromo-2,2’-bipyridine
TRC-B680575-5G 5 g

6-Bromo-2,2’-bipyridine

Sign In for Pricing
View Details
DAP5 (EIF4G2) Rabbit Polyclonal Antibody
AP20486PU-N 100 µg

DAP5 (EIF4G2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bif (SH3GLB1) Rabbit Polyclonal Antibody
TA369001 100 µL

Bif (SH3GLB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GABPB2 Rabbit Polyclonal Antibody
TA373005 100 µL

GABPB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mrpl34 (NM_053162) Mouse Tagged ORF Clone
MG200245 10 µg

Mrpl34 (NM_053162) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Hexanoic-2,2-d2 Acid
TRC-H292146-10MG 10 mg

Hexanoic-2,2-d2 Acid

Sign In for Pricing
View Details