Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKAL1 Peptide - N-terminal region

CDKAL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CDKAL1

UniProt

Q5VV42

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDKAL1 Rabbit Polyclonal Antibody (orb331431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary
CR562951 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), 0.2mg/mL
BNUB0173-500 1x 500 µL

CD45 / LCA (136-4B5), 0.2mg/mL

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) VP24 Polyclonal Antibody
E-AB-V1130-01 20 µL

Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) VP24 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) VP24 Polyclonal Antibody
E-AB-V1130-02 100 µL

Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) VP24 Polyclonal Antibody

Sign In for Pricing
View Details
FLT4 Mouse Monoclonal Antibody [Clone ID: 4H4]
AM06464SU-N 100 µL

FLT4 Mouse Monoclonal Antibody [Clone ID: 4H4]

Sign In for Pricing
View Details
Dihydrothevinone
TRC-D449840-5MG 5 mg

Dihydrothevinone

Sign In for Pricing
View Details