Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX19 Peptide - middle region

TEX19 Peptide - middle region

Product Specifications

Product Name Alternative

TEX19

UniProt

Q8NA77

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX19 Rabbit Polyclonal Antibody (orb326062) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005256425

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NC2α CRISPR/Cas9 KO Plasmid (h)
sc-408691 20 µg

NC2α CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Dap3 Rabbit pAb
E2160255 100 µL

Dap3 Rabbit pAb

Sign In for Pricing
View Details
Presenilin 2 Rabbit mAb
C05804-20uL 20 µL

Presenilin 2 Rabbit mAb

Sign In for Pricing
View Details
CDC20B, NT (CDC20B, Cell division cycle protein 20 homolog B) (MaxLight 750)
MBS6283762-01 0.1 mL

CDC20B, NT (CDC20B, Cell division cycle protein 20 homolog B) (MaxLight 750)

Sign In for Pricing
View Details
CDC20B, NT (CDC20B, Cell division cycle protein 20 homolog B) (MaxLight 750)
MBS6283762-02 5x 0.1 mL

CDC20B, NT (CDC20B, Cell division cycle protein 20 homolog B) (MaxLight 750)

Sign In for Pricing
View Details
Mouse FBXO3 siRNA
abx916627-01 15 nmol

Mouse FBXO3 siRNA

Sign In for Pricing
View Details