Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX19 Peptide - middle region

TEX19 Peptide - middle region

Product Specifications

Product Name Alternative

TEX19

UniProt

Q8NA77

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX19 Rabbit Polyclonal Antibody (orb326062) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005256425

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICG sgRNA CRISPR Lentivector (Human) (Target 2)
K1302303 1.0 µg DNA

MICG sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
AIF (E-1) Alexa Fluor® 647
sc-13116 AF647 200 µg/mL

AIF (E-1) Alexa Fluor® 647

Sign In for Pricing
View Details
Fut11 Mouse Pre-designed siRNA Set A
HY-RS22520 1 Set

Fut11 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Hel-N1 Rabbit Polyclonal Antibody
E53P04378 100 µL

Hel-N1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lycodoline
orb1684436 5 mg

Lycodoline

Sign In for Pricing
View Details
Fam19a1 (NM_182808) Mouse Tagged Lenti ORF Clone
MR213089L4 10 µg

Fam19a1 (NM_182808) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details