NFYC Peptide - C-terminal region
NFYC Peptide - C-terminal region
Product Specifications
Product Name Alternative
NFYC
UniProt
Q13952
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NFYC Rabbit Polyclonal Antibody (orb588142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![FKBP6 Rabbit Monoclonal Antibody [Clone ID: R05-4G2]](https://cdn.genprice.uk/products/937/6868c2ff994c49e6dc3ebfac/imageurl/ta421450.webp)
TA421450 100 µL
FKBP6 Rabbit Monoclonal Antibody [Clone ID: R05-4G2]
Sign In for Pricing
View Details 
BNCB1675-500 1x 500 µL
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1800-500 1x 500 µL
HSV1 (Herpes Simplex Virus Type I) (N/A), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details