Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFYC Peptide - C-terminal region

NFYC Peptide - C-terminal region

Product Specifications

Product Name Alternative

NFYC

UniProt

Q13952

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFYC Rabbit Polyclonal Antibody (orb588142) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD21 (NM_001029859) Human Recombinant Protein
TP306177L 1 mg

KCTD21 (NM_001029859) Human Recombinant Protein

Sign In for Pricing
View Details
Human Tomosyn (STXBP5) activation kit by CRISPRa
GA115240 1 Kit

Human Tomosyn (STXBP5) activation kit by CRISPRa

Sign In for Pricing
View Details
MR1 Human Gene Knockout Kit (CRISPR)
KN220474 1 Kit

MR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
15-Acetyl Deoxynivalenol (~90%)
TRC-A173515-2.5MG 2.5 mg

15-Acetyl Deoxynivalenol (~90%)

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF640R conjugate, 0.1mg/mL
BNC402416-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BIN1 Antibody
KC-1332-01 50 μL

BIN1 Antibody

Sign In for Pricing
View Details