Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL23 Peptide - middle region

CCL23 Peptide - middle region

Product Specifications

Product Name Alternative

CCL23, MIP3, MPIF1, SCYA23

UniProt

P55773

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCL23 Rabbit Polyclonal Antibody (orb329584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665905

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SADCCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ahcyl1 Mouse Gene Knockout Kit (CRISPR)
KN501007 1 Kit

Ahcyl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(4-Bromobutyl)triphenylphosphonium Bromide
TRC-B681950-250MG 250 mg

(4-Bromobutyl)triphenylphosphonium Bromide

Sign In for Pricing
View Details
4ml polycarbonate vial, bag of 240, for use with 3/8” SS grinding ball
IPD9600-4PC 1 Each

4ml polycarbonate vial, bag of 240, for use with 3/8” SS grinding ball

Sign In for Pricing
View Details
Nano Spectrophotometer BSNA-101
BSNA-101 1 Unit

Nano Spectrophotometer BSNA-101

Sign In for Pricing
View Details
Recombinant HDAC2 Antibody
RC-5276-01 50 μL

Recombinant HDAC2 Antibody

Sign In for Pricing
View Details
Recombinant HDAC2 Antibody
RC-5276-02 100 µL

Recombinant HDAC2 Antibody

Sign In for Pricing
View Details