Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL23 Peptide - middle region

CCL23 Peptide - middle region

Product Specifications

Product Name Alternative

CCL23, MIP3, MPIF1, SCYA23

UniProt

P55773

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCL23 Rabbit Polyclonal Antibody (orb329584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665905

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SADCCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Polyporus squamosus Lectin (mushroom) -PSL-
F-9006-1 1 mg

FITC Conjugated Polyporus squamosus Lectin (mushroom) -PSL-

Sign In for Pricing
View Details
MAGT1 (NM_032121) Human Over-expression Lysate
LC432198 20 µg

MAGT1 (NM_032121) Human Over-expression Lysate

Sign In for Pricing
View Details
ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF405S conjugate, 0.1mg/mL
BNC042426-500 1x 500 µL

ZFYVE28 (Zinc Finger FYVE-type containing 28) (LST2/2426), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BRUNOL5 (CELF5) (NM_021938) Human Recombinant Protein
TP307072M 100 µg

BRUNOL5 (CELF5) (NM_021938) Human Recombinant Protein

Sign In for Pricing
View Details
1,3-Dithietan-2-imine Hydrochloride
TRC-D492405-50MG 50 mg

1,3-Dithietan-2-imine Hydrochloride

Sign In for Pricing
View Details
Recombinant Human AGO2/Argonaute 2/EIF2C2 Protein (His Tag)
PKSH031271-01 100 µg

Recombinant Human AGO2/Argonaute 2/EIF2C2 Protein (His Tag)

Sign In for Pricing
View Details