Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBRP Peptide - N-terminal region

GBRP Peptide - N-terminal region

Product Specifications

Product Name Alternative

GABRP

UniProt

O00591

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055026

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTERMCIQGSQFNVEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ADP ribosylation factor like protein 5B (ARL5B) ELISA kit
GTR10391181 96 Well

Mouse ADP ribosylation factor like protein 5B (ARL5B) ELISA kit

Sign In for Pricing
View Details
SPAA-52 (ammonium)
HY-151591A 1 Each

SPAA-52 (ammonium)

Sign In for Pricing
View Details
Recombinant Human IL-10
P5165-1mg 1 mg

Recombinant Human IL-10

Sign In for Pricing
View Details
Recombinant Human MKNK2 Protein
E30P5805 20 µg

Recombinant Human MKNK2 Protein

Sign In for Pricing
View Details
Lentiviral mouse Ttc30a2 shRNA (UAS) - Lentiviral mouse Ttc30a2 shRNA (UAS, iRFP) (100)
GTR15199323 1 Vial

Lentiviral mouse Ttc30a2 shRNA (UAS) - Lentiviral mouse Ttc30a2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
ERK2 Antibody
E93630 100 µg

ERK2 Antibody

Sign In for Pricing
View Details