Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBRP Peptide - N-terminal region

GBRP Peptide - N-terminal region

Product Specifications

Product Name Alternative

GABRP

UniProt

O00591

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055026

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTERMCIQGSQFNVEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal CNGB3 Antibody - N-terminal region
APG03226G 0.05mg

Polyclonal CNGB3 Antibody - N-terminal region

Sign In for Pricing
View Details
BDKRB2 Human Gene Knockout Kit (CRISPR)
KN210378 1 Kit

BDKRB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cellufine MAX DexS-Hbp
21-704 10 lt

Cellufine MAX DexS-Hbp

Sign In for Pricing
View Details
Recombinant Chicken Occludin (OCLN)
orb2914049-01 20 µg

Recombinant Chicken Occludin (OCLN)

Sign In for Pricing
View Details
Recombinant Chicken Occludin (OCLN)
orb2914049-02 100 µg

Recombinant Chicken Occludin (OCLN)

Sign In for Pricing
View Details
HSP105 Rabbit Polyclonal Antibody (Biotin)
orb457705 100 µL

HSP105 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details