Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCSER1 Peptide - middle region

CCSER1 Peptide - middle region

Product Specifications

Product Name Alternative

FAM190A

UniProt

Q9C0I3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCSER1 Rabbit Polyclonal Antibody (orb326065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_997374

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLSSGKSEGDDSGFTEDQTRRSVKQSTRKLLPKSFSSHYKFSKPVLQSQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endostatin Rabbit pAb, Pacific Blue conjugated
orb2851799 100 µL

Endostatin Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Human IL17A Protein
orb1477795-01 20 µg

Human IL17A Protein

Sign In for Pricing
View Details
Human IL17A Protein
orb1477795-02 100 µg

Human IL17A Protein

Sign In for Pricing
View Details
Human IL17A Protein
orb1477795-03 1 mg

Human IL17A Protein

Sign In for Pricing
View Details
Lentiviral human TFIP11 shRNA (UAS) - Lentiviral human TFIP11 shRNA (UAS) (25)
GTR15088049 1 Vial

Lentiviral human TFIP11 shRNA (UAS) - Lentiviral human TFIP11 shRNA (UAS) (25)

Sign In for Pricing
View Details
Rabbit Decorin (DCN) ELISA Kit
orb1669808-01 48 Tests

Rabbit Decorin (DCN) ELISA Kit

Sign In for Pricing
View Details