CCSER1 Peptide - middle region
CCSER1 Peptide - middle region
Product Specifications
Product Name Alternative
FAM190A
UniProt
Q9C0I3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCSER1 Rabbit Polyclonal Antibody (orb326065) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_997374
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CLSSGKSEGDDSGFTEDQTRRSVKQSTRKLLPKSFSSHYKFSKPVLQSQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
134363-AP 100 µL
TFCP2 (Alpha-globin Transcription Factor CP2, SAA3 Enhancer Factor, Transcription Factor LSF, LSF, SEF) (AP) discontinued
Sign In for Pricing
View Details 