Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUFY2 Peptide - middle region

RUFY2 Peptide - middle region

Product Specifications

Product Name Alternative

RUFY2, KIAA1537, RABIP4R

UniProt

Q8WXA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RUFY2 Rabbit Polyclonal Antibody (orb588515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEARRQLRDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Ovary: left
CR562934 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
5-Nitrobenzene-1,3-Dicarboxylic Acid
TRC-N494790-50G 50 g

5-Nitrobenzene-1,3-Dicarboxylic Acid

Sign In for Pricing
View Details
ARPM1 (ACTRT3) (NM_032487) Human Recombinant Protein
TP303548L 1 mg

ARPM1 (ACTRT3) (NM_032487) Human Recombinant Protein

Sign In for Pricing
View Details
Cyclotris(1,4-butylene Terephthalate)
TRC-C988975-10MG 10 mg

Cyclotris(1,4-butylene Terephthalate)

Sign In for Pricing
View Details
Tenuazonic Acid Copper Salt
TRC-T019620-1MG 1 mg

Tenuazonic Acid Copper Salt

Sign In for Pricing
View Details
CD3e (RIV9), CF568 conjugate, 0.1mg/mL
BNC680322-500 1x 500 µL

CD3e (RIV9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details