Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUFY2 Peptide - middle region

RUFY2 Peptide - middle region

Product Specifications

Product Name Alternative

RUFY2, KIAA1537, RABIP4R

UniProt

Q8WXA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RUFY2 Rabbit Polyclonal Antibody (orb588515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEARRQLRDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1B Antibody
OC-057-01 50 μL

PPM1B Antibody

Sign In for Pricing
View Details
PPM1B Antibody
OC-057-02 100 µL

PPM1B Antibody

Sign In for Pricing
View Details
PPM1B Antibody
OC-057-03 1 mL

PPM1B Antibody

Sign In for Pricing
View Details
7-Bromo-DL-tryptophan (contains up to 20% inorganics)
TRC-B679025-500MG 500 mg

7-Bromo-DL-tryptophan (contains up to 20% inorganics)

Sign In for Pricing
View Details
IKK beta (IKBKB) Rabbit Polyclonal Antibody
TA384508 100 µL

IKK beta (IKBKB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant BORA Antibody
RC-4430-01 50 μL

Recombinant BORA Antibody

Sign In for Pricing
View Details