Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM5 Peptide - N-terminal region

GSTM5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GTM5, GSTM5-5

UniProt

P46439

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000842.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 Polyclonal Antibody, Cy5 Conjugated
bs-1620R-Cy5 100 µL

CDX2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Nitric oxide synthase, endothelial
MBS2888836 Inquire

Nitric oxide synthase, endothelial

Sign In for Pricing
View Details
α-dystroglycan (2237E2D1) : m-IgG Fc BP-HRP Bundle
sc-539186 1 Kit

α-dystroglycan (2237E2D1) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
GPR21 Antibody
MBS9604316-01 0.1 mL

GPR21 Antibody

Sign In for Pricing
View Details
GPR21 Antibody
MBS9604316-02 0.2 mL

GPR21 Antibody

Sign In for Pricing
View Details
GPR21 Antibody
MBS9604316-03 5x 0.2 mL

GPR21 Antibody

Sign In for Pricing
View Details