Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM5 Peptide - N-terminal region

GSTM5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GTM5, GSTM5-5

UniProt

P46439

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000842.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OBP2B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV648902 1.0 µg DNA

OBP2B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (Biotin)
MBS6145424-01 0.1 mL

GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (Biotin)

Sign In for Pricing
View Details
GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (Biotin)
MBS6145424-02 5x 0.1 mL

GTF3A (Transcription Factor IIIA, General Transcription Factor IIIA, AP2, TFIIIA) (Biotin)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) LAF1 Polyclonal Antibody
MBS9011188 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) LAF1 Polyclonal Antibody

Sign In for Pricing
View Details
CELF-1 Conjugated Antibody
orb1623611 100 µL

CELF-1 Conjugated Antibody

Sign In for Pricing
View Details
EGFL6 Lentiviral Activation Particles (h)
sc-411850-LAC 200 µL

EGFL6 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details