Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGR2 Peptide - middle region

SYNGR2 Peptide - middle region

Product Specifications

UniProt

O43760

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004701.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Iqcf3 ELISA Kit
ELI-37850r 96 Tests

Rat Iqcf3 ELISA Kit

Sign In for Pricing
View Details
Human alpha 2 Glycine Receptor (GLRA2) (NM_001171942) AAV Particle
RC229945A1V 250 µL

Human alpha 2 Glycine Receptor (GLRA2) (NM_001171942) AAV Particle

Sign In for Pricing
View Details
MTMR9 Antibody
MBS7134838-01 0.05 mL

MTMR9 Antibody

Sign In for Pricing
View Details
MTMR9 Antibody
MBS7134838-02 0.1 mL

MTMR9 Antibody

Sign In for Pricing
View Details
MTMR9 Antibody
MBS7134838-03 5x 0.1 mL

MTMR9 Antibody

Sign In for Pricing
View Details
ZSCAN2 Peptide
MBS3229951-01 0.1 mg

ZSCAN2 Peptide

Sign In for Pricing
View Details