Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmed1 Peptide - C-terminal region

Tmed1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

St2l, Ly84l, Il1rl1l

UniProt

Q3V009

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMED1 Rabbit Polyclonal Antibody (orb588778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034874.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLERVNFWSAAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (LK2H10 + PHE5 + CGA414), CF594 conjugate, 0.1mg/mL
BNC941223-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5 + CGA414), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1014), CF640R conjugate, 0.1mg/mL
BNC400224-500 1x 500 µL

Major Vault Protein (MVP) (1014), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PMP22 Recombinant Rabbit monoclonal Antibody
HA750425 100 µL

PMP22 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human Heat Shock Transcription Factor 1 (HSF1) ELISA Kit
RD-HSF1-Hu-01 96 Tests

Human Heat Shock Transcription Factor 1 (HSF1) ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Transcription Factor 1 (HSF1) ELISA Kit
RD-HSF1-Hu-02 48 Tests

Human Heat Shock Transcription Factor 1 (HSF1) ELISA Kit

Sign In for Pricing
View Details
Ochratoxin B-d5
TRC-O148502-2.5MG 2.5 mg

Ochratoxin B-d5

Sign In for Pricing
View Details