Tmed1 Peptide - C-terminal region
Tmed1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
St2l, Ly84l, Il1rl1l
UniProt
Q3V009
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMED1 Rabbit Polyclonal Antibody (orb588778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034874.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLERVNFWSAAN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472287-100 1x 100 µL
SOX9 / SRY-box 9 (SOX9/2287R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB1386-100 1x 100 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1386), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2228-100 1x 100 µL
MAPK14 (CPTC-MAPK14-1), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
