Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD6 Peptide - N-terminal region

MFSD6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MMR2, hMMR2

UniProt

Q6ZSS7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD6 Rabbit Polyclonal Antibody (orb589136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060164.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]
TA501279AM 100 µL

FHL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E11]

Sign In for Pricing
View Details
Mouse Smim1 activation kit by CRISPRa
GA207960 1 Kit

Mouse Smim1 activation kit by CRISPRa

Sign In for Pricing
View Details
FOLR2 (NM_000803) Human Recombinant Protein
TP762242 50 µg

FOLR2 (NM_000803) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CEACAM21 Protein (His Tag)
PKSH032234-01 10 µg

Recombinant Human CEACAM21 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CEACAM21 Protein (His Tag)
PKSH032234-02 50 µg

Recombinant Human CEACAM21 Protein (His Tag)

Sign In for Pricing
View Details
DAZL Recombinant Rabbit Monoclonal Antibody [JA10-36]
ET1704-75 100 µL

DAZL Recombinant Rabbit Monoclonal Antibody [JA10-36]

Sign In for Pricing
View Details