Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFSD6 Peptide - N-terminal region

MFSD6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MMR2, hMMR2

UniProt

Q6ZSS7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MFSD6 Rabbit Polyclonal Antibody (orb589136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060164.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF720 activation kit by CRISPRa
GA114839 1 Kit

Human ZNF720 activation kit by CRISPRa

Sign In for Pricing
View Details
CLEC4C (NM_203503) Human Over-expression Lysate
LC404251 20 µg

CLEC4C (NM_203503) Human Over-expression Lysate

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), Biotin conjugate, 0.1mg/mL
BNCB0304-100 1x 100 µL

CD106 / VCAM1 (B-K9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ML297
SIH-553-50MG 50 mg

ML297

Sign In for Pricing
View Details
ZADH1 (PTGR2) (NM_001146155) Human Recombinant Protein
TP328839 20 µg

ZADH1 (PTGR2) (NM_001146155) Human Recombinant Protein

Sign In for Pricing
View Details
Calbindin Recombinant Rabbit Monoclonal Antibody [JF05-01]
ET1702-54 100 µL

Calbindin Recombinant Rabbit Monoclonal Antibody [JF05-01]

Sign In for Pricing
View Details