HMGCS2 Peptide - middle region
HMGCS2 Peptide - middle region
Product Specifications
UniProt
P54868
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HMGCS2 Rabbit Polyclonal Antibody (orb588275) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001159579.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLAR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SAF2646 1 Each
Navy Flame Resistant Anti-Static Coverall Hi-Vis Strips Size XXLarge Regular
Sign In for Pricing
View Details 