Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCS2 Peptide - middle region

HMGCS2 Peptide - middle region

Product Specifications

UniProt

P54868

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMGCS2 Rabbit Polyclonal Antibody (orb588275) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001159579.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Y14F Antibody
orb829566 2 mg

Y14F Antibody

Sign In for Pricing
View Details
Dimethyl threo-Hydroxy-D, L-aspartate
D3693-30 25 mg

Dimethyl threo-Hydroxy-D, L-aspartate

Sign In for Pricing
View Details
Polyclonal Antibody to Nucleoredoxin (NXN)
TRV-0055062-01 20 µL

Polyclonal Antibody to Nucleoredoxin (NXN)

Sign In for Pricing
View Details
Polyclonal Antibody to Nucleoredoxin (NXN)
TRV-0055062-02 100 µL

Polyclonal Antibody to Nucleoredoxin (NXN)

Sign In for Pricing
View Details
Polyclonal Antibody to Nucleoredoxin (NXN)
TRV-0055062-03 200 µL

Polyclonal Antibody to Nucleoredoxin (NXN)

Sign In for Pricing
View Details
Polyclonal Antibody to Nucleoredoxin (NXN)
TRV-0055062-04 1 mL

Polyclonal Antibody to Nucleoredoxin (NXN)

Sign In for Pricing
View Details