Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5MF Peptide - middle region

ATP5MF Peptide - middle region

Product Specifications

Product Name Alternative

ATP5J2, ATP5JL

UniProt

G3V325

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP5MF Rabbit Polyclonal Antibody (orb589221) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003713.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITM

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pacific Blue™ anti-human CD138 (Syndecan-1)
GT13712 100 Tests

Pacific Blue™ anti-human CD138 (Syndecan-1)

Sign In for Pricing
View Details
JARID2-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV730188 1.0 µg DNA

JARID2-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
TAO2 (C-2) : m-IgGκ BP-HRP Bundle
sc-524667 1 Kit

TAO2 (C-2) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Native Dog Apolipoprotein A1 (APOA1) Protein
APOA1-23D 10 µg

Native Dog Apolipoprotein A1 (APOA1) Protein

Sign In for Pricing
View Details
PCMT1 Recombinant Protein
OPCD06014-200UG 200 µg

PCMT1 Recombinant Protein

Sign In for Pricing
View Details
MCT14 HDR Plasmid (h)
sc-414704-HDR 20 µg

MCT14 HDR Plasmid (h)

Sign In for Pricing
View Details