Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5MF Peptide - middle region

ATP5MF Peptide - middle region

Product Specifications

Product Name Alternative

ATP5J2, ATP5JL

UniProt

G3V325

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP5MF Rabbit Polyclonal Antibody (orb589221) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001003713.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITM

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey C1q (Complement 1q) ELISA Kit
MBS2567442-01 24 Tests (Limit 1)

Monkey C1q (Complement 1q) ELISA Kit

Sign In for Pricing
View Details
Monkey C1q (Complement 1q) ELISA Kit
MBS2567442-02 48 Tests

Monkey C1q (Complement 1q) ELISA Kit

Sign In for Pricing
View Details
Monkey C1q (Complement 1q) ELISA Kit
MBS2567442-03 96 Tests

Monkey C1q (Complement 1q) ELISA Kit

Sign In for Pricing
View Details
Monkey C1q (Complement 1q) ELISA Kit
MBS2567442-04 5x 96 Tests

Monkey C1q (Complement 1q) ELISA Kit

Sign In for Pricing
View Details
Monkey C1q (Complement 1q) ELISA Kit
MBS2567442-05 10x 96 Tests

Monkey C1q (Complement 1q) ELISA Kit

Sign In for Pricing
View Details
PABIR2 (NM_145284) Human Mass Spec Standard
PH322071 10 µg

PABIR2 (NM_145284) Human Mass Spec Standard

Sign In for Pricing
View Details