NT5C3A Peptide - middle region
NT5C3A Peptide - middle region
Product Specifications
Product Name Alternative
P36, PN-I, POMP, PSN1, UMPH, NT5C3, P5N-1, UMPH1, hUMP1, P5&apos, N-1, cN-III
UniProt
Q9H0P0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NT5C3A Rabbit Polyclonal Antibody (orb589325) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001002009.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
124424-ML490 100 µL
CCDC131 (Zinc Finger, C3H1-Type Containing, CCDC131, DKFZp686A0722, KIAA0546, MGC23401, MGC90200, PSRC2) (MaxLight 490)
Sign In for Pricing
View Details 