Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yipf5 Peptide - N-terminal region

Yipf5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2610311I19Rik, AA408236, Yip1a

UniProt

Q9WUU7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Yipf5 Rabbit Polyclonal Antibody (orb579274) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071720

Preservative

Lyophilized powder

AA Sequence

DMMQPQQTYTGQIYQPTQAYPPTTPQPFYGDSFEEEPPLLEELGINFDHI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3
MBS1121261-01 0.02 mg (E-Coli)

Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3

Sign In for Pricing
View Details
Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3
MBS1121261-02 0.1 mg (E-Coli)

Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3

Sign In for Pricing
View Details
Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3
MBS1121261-03 0.02 mg (Yeast)

Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3

Sign In for Pricing
View Details
Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3
MBS1121261-04 0.1 mg (Yeast)

Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3

Sign In for Pricing
View Details
Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3
MBS1121261-05 0.02 mg (Baculovirus)

Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3

Sign In for Pricing
View Details
Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3
MBS1121261-06 0.02 mg (Mammalian-Cell)

Recombinant Acanthamoeba castellanii Proteasome subunit alpha type-3

Sign In for Pricing
View Details