Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPBWR2 Peptide - N-terminal region

NPBWR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPR8

UniProt

P48146

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPBWR2 Rabbit Polyclonal Antibody (orb586292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005277

Preservative

Lyophilized powder

AA Sequence

LPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT8 (NM_178154) Human Recombinant Protein
TP312345M 100 µg

FUT8 (NM_178154) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal Coagulation Factor X Antibody [Alexa Fluor 532]
NBP2-99698AF532 0.1 mL

Rabbit Polyclonal Coagulation Factor X Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
ZYG11B, CT (Protein zyg-11 homolog B, ZYG11B, KIAA1730) (MaxLight 650) discontinued
Z0901-ML650 100 µL

ZYG11B, CT (Protein zyg-11 homolog B, ZYG11B, KIAA1730) (MaxLight 650) discontinued

Sign In for Pricing
View Details
ZNF75CP 3'UTR Luciferase Stable Cell Line
TU028965 1.0 mL

ZNF75CP 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BL-CAM Colorimetric Cell-Based ELISA Kit (OKAG00555)
OKAG00555 96 Well

BL-CAM Colorimetric Cell-Based ELISA Kit (OKAG00555)

Sign In for Pricing
View Details
Rabbit Polyclonal SAP30L Antibody [Alexa Fluor 350]
NB100-491AF350 0.1 mL

Rabbit Polyclonal SAP30L Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details