Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPBWR2 Peptide - N-terminal region

NPBWR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GPR8

UniProt

P48146

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NPBWR2 Rabbit Polyclonal Antibody (orb586292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005277

Preservative

Lyophilized powder

AA Sequence

LPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGLTGNTAVI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ACP6 sgRNA gene knockout kit - Lentiviral human ACP6 sgRNA gene knockout kit (100)
GTR15366274 1 Vial

Lentiviral human ACP6 sgRNA gene knockout kit - Lentiviral human ACP6 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 750)
MBS6233698-01 0.1 mL

LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 750)

Sign In for Pricing
View Details
LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 750)
MBS6233698-02 5x 0.1 mL

LOXL2 (Lysyl Oxidase-like Protein 2, Lysyl Oxidase Related Protein 2, LOR2, Lysyl Oxidase Homolog 2, Lysyl Oxidase Related Protein WS9-14) (MaxLight 750)

Sign In for Pricing
View Details
M-Anisidine, 4- ((5-cyclohexylpentyl) oxy) -
orb1985712-01 100 mg

M-Anisidine, 4- ((5-cyclohexylpentyl) oxy) -

Sign In for Pricing
View Details
M-Anisidine, 4- ((5-cyclohexylpentyl) oxy) -
orb1985712-02 500 mg

M-Anisidine, 4- ((5-cyclohexylpentyl) oxy) -

Sign In for Pricing
View Details
ELISA Kit For LIM domain and actin-binding protein 1
E14083h 96 Tests

ELISA Kit For LIM domain and actin-binding protein 1

Sign In for Pricing
View Details