Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKAP14 Peptide - N-terminal region

AKAP14 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AKAP14, AKAP28

UniProt

Q86UN6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKAP14 Rabbit Polyclonal Antibody (orb588029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAVKIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cacna1i Mouse Gene Knockout Kit (CRISPR)
KN502421 1 Kit

Cacna1i Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C14orf43 (ELMSAN1) (NM_194278) Human Over-expression Lysate
LY403662 100 µg

C14orf43 (ELMSAN1) (NM_194278) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rat CCl2 protein (His tag)
PDMR100017-01 20 µg

Recombinant Rat CCl2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CCl2 protein (His tag)
PDMR100017-02 100 µg

Recombinant Rat CCl2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CCl2 protein (His tag)
PDMR100017-03 500 µg

Recombinant Rat CCl2 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CCl2 protein (His tag)
PDMR100017-04 1 mg

Recombinant Rat CCl2 protein (His tag)

Sign In for Pricing
View Details