AKAP14 Peptide - N-terminal region
AKAP14 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AKAP14, AKAP28
UniProt
Q86UN6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AKAP14 Rabbit Polyclonal Antibody (orb588029) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAVKIV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GAF-002-40 1 mL
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgA, 40nm
Sign In for Pricing
View Details 
BNC741646-500 1x 500 µL
CD99 / MIC2 (Ewing's Sarcoma Marker), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 